Lineage for d2fp4a1 (2fp4 A:2-130)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 822143Family c.2.1.8: CoA-binding domain [51900] (5 proteins)
  6. 822160Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (3 species)
  7. 822186Species Pig (Sus scrofa) [TaxId:9823] [51903] (6 PDB entries)
  8. 822189Domain d2fp4a1: 2fp4 A:2-130 [133895]
    Other proteins in same PDB: d2fp4a2, d2fp4b1, d2fp4b2
    automatically matched to d1euca1
    complexed with gtp, k, mg

Details for d2fp4a1

PDB Entry: 2fp4 (more details), 2.08 Å

PDB Description: Crystal structure of pig GTP-specific succinyl-CoA synthetase in complex with GTP
PDB Compounds: (A:) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial

SCOP Domain Sequences for d2fp4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fp4a1 c.2.1.8 (A:2-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]}
sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
qgktrligp

SCOP Domain Coordinates for d2fp4a1:

Click to download the PDB-style file with coordinates for d2fp4a1.
(The format of our PDB-style files is described here.)

Timeline for d2fp4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fp4a2