SCOPe 2.02: Domain d2foya_: 2foy A:

Lineage for d2foya_ (2foy A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (16 PDB entries)

8. Domain d2foya_: 2foy A: [133889]
   automated match to d1bzm__
   complexed with b30, zn

Details for d2foya_

PDB Entry: 2foy, 1.55 Å

PDB Description: human carbonic anhydrase i complexed with a two-prong inhibitor

PDB Compounds: (A:) Carbonic anhydrase 1

SCOPe Domain Sequences for d2foya_:

Sequence; same for both SEQRES and ATOM records:

>d2foya_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

Timeline for d2foya_:

• d2foya_ first appeared in SCOP 1.73, called d2foya1
  
• d2foya_ appears in SCOPe 2.01
  
• d2foya_ appears in SCOPe 2.03
  
• d2foya_ appears in the current release, SCOPe 2.08