SCOPe 2.06: Domain d2fomb1: 2fom B:18-167

Lineage for d2fomb1 (2fom B:18-167)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein NS3 protease [50600] (5 species)

7. Species Dengue virus type 2 [TaxId:11060] [50602] (1 PDB entry)

8. Domain d2fomb1: 2fom B:18-167 [133884]
   Other proteins in same PDB: d2foma1, d2foma2, d2foma3
   complexed with NS2B peptide cofactor
   complexed with cl, gol

Details for d2fomb1

PDB Entry: 2fom, 1.5 Å

PDB Description: dengue virus ns2b/ns3 protease

PDB Compounds: (B:) Polyprotein

SCOPe Domain Sequences for d2fomb1:

Sequence; same for both SEQRES and ATOM records:

>d2fomb1 b.47.1.3 (B:18-167) NS3 protease {Dengue virus type 2 [TaxId: 11060]}
ledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkriepswadvkkdli
sygggwklegewkegeevqvlalepgknpravqtkpglfktntgtigavsldfspgtsgs
pivdkkgkvvglygngvvtrsgayvsaian

Timeline for d2fomb1:

• d2fomb1 first appeared in SCOP 1.73
  
• d2fomb1 appears in SCOPe 2.05
  
• d2fomb1 appears in SCOPe 2.07
  
• d2fomb1 appears in the current release, SCOPe 2.08