Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein NS3 protease [50600] (5 species) |
Species Dengue virus type 2 [TaxId:11060] [50602] (1 PDB entry) |
Domain d2fomb1: 2fom B:18-167 [133884] complexed with NS2B peptide cofactor complexed with cl, gol |
PDB Entry: 2fom (more details), 1.5 Å
SCOPe Domain Sequences for d2fomb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fomb1 b.47.1.3 (B:18-167) NS3 protease {Dengue virus type 2 [TaxId: 11060]} ledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkriepswadvkkdli sygggwklegewkegeevqvlalepgknpravqtkpglfktntgtigavsldfspgtsgs pivdkkgkvvglygngvvtrsgayvsaian
Timeline for d2fomb1: