Lineage for d2fo1a2 (2fo1 A:196-380)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2768412Family b.2.5.8: DNA-binding protein LAG-1 (CSL) [110080] (1 protein)
  6. 2768413Protein DNA-binding protein LAG-1 (CSL) [110081] (1 species)
  7. 2768414Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110082] (4 PDB entries)
    Uniprot Q9TYY1 195-660
  8. 2768418Domain d2fo1a2: 2fo1 A:196-380 [133866]
    Other proteins in same PDB: d2fo1a1, d2fo1a3, d2fo1d1, d2fo1e1
    automatically matched to d1ttua2
    protein/DNA complex

Details for d2fo1a2

PDB Entry: 2fo1 (more details), 3.12 Å

PDB Description: Crystal Structure of the CSL-Notch-Mastermind ternary complex bound to DNA
PDB Compounds: (A:) Lin-12 and glp-1 phenotype protein 1, isoform b

SCOPe Domain Sequences for d2fo1a2:

Sequence, based on SEQRES records: (download)

>d2fo1a2 b.2.5.8 (A:196-380) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
qsltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciyligqgwklkkdr
vaqlyktlkasaqkdaaiendpiheqqatelvayigigsdtserqqldfstgkvrhpgdq
rqdpniydycaaktlyisdsdkrkyfdlnaqffygcgmeiggfvsqrikviskpskkkqs
mkntd

Sequence, based on observed residues (ATOM records): (download)

>d2fo1a2 b.2.5.8 (A:196-380) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
qsltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciyligqgwklkkdr
vaqlyktlkasaiheqqatelvayigigsdtserqqldfstgkvrhpniydycaaktlyi
sdsdkrkyfdlnaqffygcgmeiggfvsqrikviskpskkd

SCOPe Domain Coordinates for d2fo1a2:

Click to download the PDB-style file with coordinates for d2fo1a2.
(The format of our PDB-style files is described here.)

Timeline for d2fo1a2: