Lineage for d2fo0a1 (2fo0 A:65-138)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782866Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)
  7. 2782867Species Human (Homo sapiens) [TaxId:9606] [50054] (6 PDB entries)
  8. 2782872Domain d2fo0a1: 2fo0 A:65-138 [133862]
    Other proteins in same PDB: d2fo0a2, d2fo0a3
    automated match to d2fo0a1
    complexed with gol, myr, p16

Details for d2fo0a1

PDB Entry: 2fo0 (more details), 2.27 Å

PDB Description: organization of the sh3-sh2 unit in active and inactive forms of the c-abl tyrosine kinase
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1 (1B ISOFORM)

SCOPe Domain Sequences for d2fo0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fo0a1 b.34.2.1 (A:65-138) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
arwnskenllagpsendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtk
ngqgwvpsnyitpv

SCOPe Domain Coordinates for d2fo0a1:

Click to download the PDB-style file with coordinates for d2fo0a1.
(The format of our PDB-style files is described here.)

Timeline for d2fo0a1: