SCOP 1.73: Domain d2fnyk1: 2fny K:1-211

Lineage for d2fnyk1 (2fny K:1-211)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (3 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (9 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d2fnyk1: 2fny K:1-211 [133846]
   Other proteins in same PDB: d2fnya1, d2fnyb1, d2fnyc1, d2fnyd1, d2fnye1, d2fnyf1, d2fnyg1, d2fnyo1, d2fnyp1, d2fnyq1, d2fnyr1, d2fnys1, d2fnyt1, d2fnyu1
   automatically matched to d1g0uk_
   complexed with esy

Details for d2fnyk1

PDB Entry: 2fny, 3 Å

PDB Description: Homobelactosin C bound to the yeast 20S proteasome

PDB Compounds: (K:) Proteasome component PRE2

SCOP Domain Sequences for d2fnyk1:

Sequence; same for both SEQRES and ATOM records:

>d2fnyk1 d.153.1.4 (K:1-211) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

Timeline for d2fnyk1:

• d2fnyk1 is new in SCOP 1.73
  
• d2fnyk1 does not appear in SCOP 1.75