Lineage for d2fnob1 (2fno B:88-236)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1492149Protein Hypothetical protein AGR_pAT_752p/Atu5508 [140558] (1 species)
    putative glutathione S-transferase
  7. 1492150Species Agrobacterium tumefaciens [TaxId:358] [140559] (1 PDB entry)
    Uniprot Q7D2W7 88-236
  8. 1492152Domain d2fnob1: 2fno B:88-236 [133823]
    Other proteins in same PDB: d2fnoa2, d2fnob2
    automated match to d2fnoa1
    complexed with scn

Details for d2fnob1

PDB Entry: 2fno (more details), 2 Å

PDB Description: Crystal structure of a glutathione s-transferase (atu5508) from agrobacterium tumefaciens str. c58 at 2.00 A resolution
PDB Compounds: (B:) AGR_pAT_752p

SCOPe Domain Sequences for d2fnob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnob1 a.45.1.1 (B:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]}
lpatvegrtlsakivndandvldeltlnggremwtpekwqefvprlqkwirifadtgarn
glsaasgfmlgtekigvadivtailwttvadrfpaikgiiedtspiiwglsrrvvatapl
aalnsksfeeygnaycggeiekslrkvas

SCOPe Domain Coordinates for d2fnob1:

Click to download the PDB-style file with coordinates for d2fnob1.
(The format of our PDB-style files is described here.)

Timeline for d2fnob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fnob2