SCOP 1.73: Domain d2fnjb1: 2fnj B:1-98

Lineage for d2fnjb1 (2fnj B:1-98)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (7 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
   Pfam PF00240

6. Protein Elongin B [54246] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [142930] (1 PDB entry)

8. Domain d2fnjb1: 2fnj B:1-98 [133819]
   Other proteins in same PDB: d2fnja1, d2fnjc1

Details for d2fnjb1

PDB Entry: 2fnj, 1.8 Å

PDB Description: crystal structure of a b30.2/spry domain-containing protein gustavus in complex with elongin b and elongin c

PDB Compounds: (B:) Transcription elongation factor B polypeptide 2

SCOP Domain Sequences for d2fnjb1:

Sequence; same for both SEQRES and ATOM records:

>d2fnjb1 d.15.1.1 (B:1-98) Elongin B {Mouse (Mus musculus) [TaxId: 10090]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppeeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealriepfssppe

Timeline for d2fnjb1:

• d2fnjb1 is new in SCOP 1.73
  
• d2fnjb1 appears in SCOP 1.75
  
• d2fnjb1 appears in the current release, SCOPe 2.08