Lineage for d2fn3a3 (2fn3 A:342-525)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694610Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 694611Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 694852Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 694876Protein Benzoylformate decarboxylase [88756] (1 species)
  7. 694877Species Pseudomonas putida [TaxId:303] [88757] (8 PDB entries)
  8. 694879Domain d2fn3a3: 2fn3 A:342-525 [133805]
    Other proteins in same PDB: d2fn3a1, d2fn3a2
    automatically matched to d1mcza3
    complexed with ca, mg, tzd; mutant

Details for d2fn3a3

PDB Entry: 2fn3 (more details), 1 Å

PDB Description: High resolution structure of s26a mutant of benzoylformate decarboxylase from pseudomonas putida complexed with thiamine thiazolone diphosphate
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOP Domain Sequences for d2fn3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fn3a3 c.36.1.9 (A:342-525) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvs

SCOP Domain Coordinates for d2fn3a3:

Click to download the PDB-style file with coordinates for d2fn3a3.
(The format of our PDB-style files is described here.)

Timeline for d2fn3a3: