Lineage for d2fn3a1 (2fn3 A:182-341)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694236Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 694237Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 694262Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 694286Protein Benzoylformate decarboxylase [52482] (1 species)
  7. 694287Species Pseudomonas putida [TaxId:303] [52483] (8 PDB entries)
  8. 694289Domain d2fn3a1: 2fn3 A:182-341 [133803]
    Other proteins in same PDB: d2fn3a2, d2fn3a3
    automatically matched to d1bfd_1
    complexed with ca, mg, tzd; mutant

Details for d2fn3a1

PDB Entry: 2fn3 (more details), 1 Å

PDB Description: High resolution structure of s26a mutant of benzoylformate decarboxylase from pseudomonas putida complexed with thiamine thiazolone diphosphate
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOP Domain Sequences for d2fn3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fn3a1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

SCOP Domain Coordinates for d2fn3a1:

Click to download the PDB-style file with coordinates for d2fn3a1.
(The format of our PDB-style files is described here.)

Timeline for d2fn3a1: