Lineage for d2fmpa3 (2fmp A:149-335)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2239280Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2239281Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2239289Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2239290Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 2239291Species Human (Homo sapiens) [TaxId:9606] [81574] (145 PDB entries)
    Uniprot P06746
  8. 2239293Domain d2fmpa3: 2fmp A:149-335 [133788]
    Other proteins in same PDB: d2fmpa1, d2fmpa2
    automated match to d1tv9a3
    protein/DNA complex; complexed with dct, mg, na

Details for d2fmpa3

PDB Entry: 2fmp (more details), 1.65 Å

PDB Description: DNA Polymerase beta with a terminated gapped DNA substrate and ddCTP with sodium in the catalytic site
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d2fmpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmpa3 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

SCOPe Domain Coordinates for d2fmpa3:

Click to download the PDB-style file with coordinates for d2fmpa3.
(The format of our PDB-style files is described here.)

Timeline for d2fmpa3: