Lineage for d2fmpa1 (2fmp A:10-91)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493774Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1493775Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 1493776Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 1493777Species Human (Homo sapiens) [TaxId:9606] [47805] (143 PDB entries)
    Uniprot P06746
  8. 1493779Domain d2fmpa1: 2fmp A:10-91 [133786]
    Other proteins in same PDB: d2fmpa2, d2fmpa3
    automated match to d1tv9a1
    protein/DNA complex; complexed with dct, mg, na

Details for d2fmpa1

PDB Entry: 2fmp (more details), 1.65 Å

PDB Description: DNA Polymerase beta with a terminated gapped DNA substrate and ddCTP with sodium in the catalytic site
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d2fmpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmpa1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

SCOPe Domain Coordinates for d2fmpa1:

Click to download the PDB-style file with coordinates for d2fmpa1.
(The format of our PDB-style files is described here.)

Timeline for d2fmpa1: