Lineage for d2floc1 (2flo C:313-506)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737150Family a.211.1.5: Ppx associated domain [140773] (1 protein)
    this domain is C-terminal to Ppx domain in some Exopolyphosphatases
  6. 2737151Protein Exopolyphosphatase Ppx C-terminal domain [140774] (1 species)
  7. 2737152Species Escherichia coli [TaxId:562] [140775] (2 PDB entries)
    Uniprot P0AFL6 312-508
  8. 2737157Domain d2floc1: 2flo C:313-506 [133739]
    Other proteins in same PDB: d2floa2, d2floa3, d2flob2, d2flob3, d2floc2, d2floc3, d2flod2, d2flod3
    automated match to d2flob1

Details for d2floc1

PDB Entry: 2flo (more details), 2.2 Å

PDB Description: crystal structure of exopolyphosphatase (ppx) from e. coli o157:h7
PDB Compounds: (C:) exopolyphosphatase

SCOPe Domain Sequences for d2floc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2floc1 a.211.1.5 (C:313-506) Exopolyphosphatase Ppx C-terminal domain {Escherichia coli [TaxId: 562]}
dvrsrtasslanqyhidseqarrvldttmqmyeqwreqqpklahpqleallrwaamlhev
glninhsglhrhsayilqnsdlpgfnqeqqlmmatlvryhrkaiklddlprftlfkkkqf
lpliqllrlgvllnnqrqatttpptltlitddshwtlrfphdwfsqnalvlldlekeqey
wegvagwrlkieee

SCOPe Domain Coordinates for d2floc1:

Click to download the PDB-style file with coordinates for d2floc1.
(The format of our PDB-style files is described here.)

Timeline for d2floc1: