Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.8: Ppx/GppA phosphatase [110630] (2 proteins) Pfam PF02541 |
Protein Exopolyphosphatase Ppx [110631] (2 species) |
Species Escherichia coli [TaxId:562] [142466] (2 PDB entries) Uniprot P0AFL6 11-134! Uniprot P0AFL6 135-311 |
Domain d2floa3: 2flo A:136-312 [133735] Other proteins in same PDB: d2floa1, d2flob1, d2floc1, d2flod1 automated match to d1u6za3 |
PDB Entry: 2flo (more details), 2.2 Å
SCOPe Domain Sequences for d2floa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2floa3 c.55.1.8 (A:136-312) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]} kgrklvidigggstelvigenfepilvesrrmgcvsfaqlyfpggvinkenfqrarmaaa qkletltwqfriqgwnvamgasgtikaahevlmemgekdgiitperleklvkevlrhrnf aslslpglseerktvfvpglailcgvfdalairelrlsdgalregvlyemegrfrhq
Timeline for d2floa3: