Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein) |
Protein Merozoite surface protein 1 (MSP-1) [57240] (3 species) |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [57242] (3 PDB entries) |
Domain d2flga1: 2flg A:1-45 [133713] automatically matched to d1ceja1 |
PDB Entry: 2flg (more details)
SCOPe Domain Sequences for d2flga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2flga1 g.3.11.4 (A:1-45) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenp
Timeline for d2flga1: