![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (24 species) not a true protein |
![]() | Species Azotobacter vinelandii [TaxId:354] [186762] (3 PDB entries) |
![]() | Domain d2fl0e_: 2fl0 E: [133700] automated match to d1bcfa_ complexed with fe2, hem, mg |
PDB Entry: 2fl0 (more details), 2.7 Å
SCOPe Domain Sequences for d2fl0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fl0e_ a.25.1.1 (E:) automated matches {Azotobacter vinelandii [TaxId: 354]} mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell edileseedhidwletqldlidkiglenylqsqmd
Timeline for d2fl0e_: