Class a: All alpha proteins [46456] (258 folds) |
Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (5 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein Bacterioferritin (cytochrome b1) [47244] (4 species) binds heme between two subunits; 24-mer |
Species Azotobacter vinelandii [TaxId:354] [140431] (3 PDB entries) |
Domain d2fkzh1: 2fkz H:1-154 [133695] automatically matched to 1SOF A:1-154 complexed with fe2, hem, mg |
PDB Entry: 2fkz (more details), 2 Å
SCOP Domain Sequences for d2fkzh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fkzh1 a.25.1.1 (H:1-154) Bacterioferritin (cytochrome b1) {Azotobacter vinelandii [TaxId: 354]} mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell edileseedhidwletqldlidkiglenylqsqm
Timeline for d2fkzh1: