| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (18 species) not a true protein |
| Species Azotobacter vinelandii [TaxId:354] [186762] (3 PDB entries) |
| Domain d2fkzc_: 2fkz C: [133690] automated match to d1bcfa_ complexed with fe2, hem, mg |
PDB Entry: 2fkz (more details), 2 Å
SCOPe Domain Sequences for d2fkzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fkzc_ a.25.1.1 (C:) automated matches {Azotobacter vinelandii [TaxId: 354]}
mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
edileseedhidwletqldlidkiglenylqsqmd
Timeline for d2fkzc_: