SCOPe 2.01: Domain d2fkxa1: 2fkx A:1-88

Lineage for d2fkxa1 (2fkx A:1-88)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
   contains additional N-terminal helix that forms a separate unit

6. Protein Ribosomal protein S15 [47065] (3 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
   Uniprot P80378

8. Domain d2fkxa1: 2fkx A:1-88 [133685]
   automatically matched to d1ab3__

Details for d2fkxa1

PDB Entry: 2fkx

PDB Description: ribosomal protein s15 from thermus thermophilus, nmr recalculated structure

PDB Compounds: (A:) 30S ribosomal protein S15

SCOPe Domain Sequences for d2fkxa1:

Sequence; same for both SEQRES and ATOM records:

>d2fkxa1 a.16.1.2 (A:1-88) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

Timeline for d2fkxa1:

• d2fkxa1 first appeared in SCOP 1.73
  
• d2fkxa1 appears in SCOP 1.75
  
• d2fkxa1 appears in SCOPe 2.02
  
• d2fkxa1 appears in the current release, SCOPe 2.08