Lineage for d2fk8a_ (2fk8 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145720Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (7 proteins)
  6. 2145739Protein Methoxy mycolic acid synthase 4, Mma4 [142591] (1 species)
  7. 2145740Species Mycobacterium tuberculosis [TaxId:1773] [142592] (5 PDB entries)
    Uniprot Q79FX8 22-301
  8. 2145741Domain d2fk8a_: 2fk8 A: [133648]
    automated match to d2fk7a1
    complexed with sam

Details for d2fk8a_

PDB Entry: 2fk8 (more details), 2 Å

PDB Description: Crystal structure of Hma (MmaA4) from Mycobacterium tuberculosis complexed with S-adenosylmethionine
PDB Compounds: (A:) methoxy mycolic acid synthase 4

SCOPe Domain Sequences for d2fk8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk8a_ c.66.1.18 (A:) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]}
iqahydvsddffalfqdptrtyscayfeppeltleeaqyakvdlnldkldlkpgmtlldi
gcgwgttmrraverfdvnvigltlsknqharceqvlasidtnrsrqvllqgwedfaepvd
rivsieafehfghenyddffkrcfnimpadgrmtvqssvsyhpyemaargkklsfetarf
ikfivteifpggrlpstemmvehgekagftvpeplslrphyiktlriwgdtlqsnkdkai
evtseevynrymkylrgcehyftdemldcslvtylkpgaaa

SCOPe Domain Coordinates for d2fk8a_:

Click to download the PDB-style file with coordinates for d2fk8a_.
(The format of our PDB-style files is described here.)

Timeline for d2fk8a_: