Lineage for d2fk8a1 (2fk8 A:22-301)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175720Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1175721Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1176138Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (7 proteins)
  6. 1176157Protein Methoxy mycolic acid synthase 4, Mma4 [142591] (1 species)
  7. 1176158Species Mycobacterium tuberculosis [TaxId:1773] [142592] (2 PDB entries)
    Uniprot Q79FX8 22-301
  8. 1176159Domain d2fk8a1: 2fk8 A:22-301 [133648]
    automatically matched to 2FK7 A:22-301
    complexed with sam

Details for d2fk8a1

PDB Entry: 2fk8 (more details), 2 Å

PDB Description: Crystal structure of Hma (MmaA4) from Mycobacterium tuberculosis complexed with S-adenosylmethionine
PDB Compounds: (A:) methoxy mycolic acid synthase 4

SCOPe Domain Sequences for d2fk8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]}
qahydvsddffalfqdptrtyscayfeppeltleeaqyakvdlnldkldlkpgmtlldig
cgwgttmrraverfdvnvigltlsknqharceqvlasidtnrsrqvllqgwedfaepvdr
ivsieafehfghenyddffkrcfnimpadgrmtvqssvsyhpyemaargkklsfetarfi
kfivteifpggrlpstemmvehgekagftvpeplslrphyiktlriwgdtlqsnkdkaie
vtseevynrymkylrgcehyftdemldcslvtylkpgaaa

SCOPe Domain Coordinates for d2fk8a1:

Click to download the PDB-style file with coordinates for d2fk8a1.
(The format of our PDB-style files is described here.)

Timeline for d2fk8a1: