SCOP 1.73: Domain d2fk8a1: 2fk8 A:22-301

Lineage for d2fk8a1 (2fk8 A:22-301)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (5 proteins)

6. Protein Methoxy mycolic acid synthase 4, Mma4 [142591] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [142592] (2 PDB entries)

8. Domain d2fk8a1: 2fk8 A:22-301 [133648]
   automatically matched to 2FK7 A:22-301
   complexed with sam

Details for d2fk8a1

PDB Entry: 2fk8, 2 Å

PDB Description: Crystal structure of Hma (MmaA4) from Mycobacterium tuberculosis complexed with S-adenosylmethionine

PDB Compounds: (A:) methoxy mycolic acid synthase 4

SCOP Domain Sequences for d2fk8a1:

Sequence; same for both SEQRES and ATOM records:

>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]}
qahydvsddffalfqdptrtyscayfeppeltleeaqyakvdlnldkldlkpgmtlldig
cgwgttmrraverfdvnvigltlsknqharceqvlasidtnrsrqvllqgwedfaepvdr
ivsieafehfghenyddffkrcfnimpadgrmtvqssvsyhpyemaargkklsfetarfi
kfivteifpggrlpstemmvehgekagftvpeplslrphyiktlriwgdtlqsnkdkaie
vtseevynrymkylrgcehyftdemldcslvtylkpgaaa

Timeline for d2fk8a1:

• d2fk8a1 is new in SCOP 1.73
  
• d2fk8a1 appears in SCOP 1.75
  
• d2fk8a1 appears in the current release, SCOPe 2.08, called d2fk8a_