Lineage for d2fk7a1 (2fk7 A:22-301)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839581Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 839582Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) (S)
  5. 839874Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (6 proteins)
  6. 839893Protein Methoxy mycolic acid synthase 4, Mma4 [142591] (1 species)
  7. 839894Species Mycobacterium tuberculosis [TaxId:1773] [142592] (2 PDB entries)
    Uniprot Q79FX8 22-301
  8. 839896Domain d2fk7a1: 2fk7 A:22-301 [133647]

Details for d2fk7a1

PDB Entry: 2fk7 (more details), 2.1 Å

PDB Description: crystal structure of hma (mmaa4) from mycobacterium tuberculosis, apo- form
PDB Compounds: (A:) methoxy mycolic acid synthase 4

SCOP Domain Sequences for d2fk7a1:

Sequence, based on SEQRES records: (download)

>d2fk7a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]}
qahydvsddffalfqdptrtyscayfeppeltleeaqyakvdlnldkldlkpgmtlldig
cgwgttmrraverfdvnvigltlsknqharceqvlasidtnrsrqvllqgwedfaepvdr
ivsieafehfghenyddffkrcfnimpadgrmtvqssvsyhpyemaargkklsfetarfi
kfivteifpggrlpstemmvehgekagftvpeplslrphyiktlriwgdtlqsnkdkaie
vtseevynrymkylrgcehyftdemldcslvtylkpgaaa

Sequence, based on observed residues (ATOM records): (download)

>d2fk7a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]}
qahydvsddffalfqdptrtyscayfeppeltleeaqyakvdlnldkldlkpgmtlldig
cgwgttmrraverfdvnvigltlsknqharceqvlasidtnrsrqvllqgwedfaepvdr
ivsieafehenyddffkrcfnimpadgrmtvqssvsyhpyemaargkklsfetarfikfi
vteifpggrlpstemmvehgekagftvpeplslrphyiktlriwgdtlqsnkdkaievts
eevynrymkylrgcehyftdemldcslvtylkpgaaa

SCOP Domain Coordinates for d2fk7a1:

Click to download the PDB-style file with coordinates for d2fk7a1.
(The format of our PDB-style files is described here.)

Timeline for d2fk7a1: