Lineage for d2fk0q_ (2fk0 Q:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117012Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1117013Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 1117058Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1117236Protein automated matches [190291] (11 species)
    not a true protein
  7. 1117240Species Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [187096] (1 PDB entry)
  8. 1117248Domain d2fk0q_: 2fk0 Q: [133644]
    Other proteins in same PDB: d2fk0a1, d2fk0b1, d2fk0d1, d2fk0f1, d2fk0h1, d2fk0j1, d2fk0l1, d2fk0n1, d2fk0p1, d2fk0r1
    automated match to d1jsma_

Details for d2fk0q_

PDB Entry: 2fk0 (more details), 2.95 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin.
PDB Compounds: (Q:) Hemagglutinin

SCOPe Domain Sequences for d2fk0q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk0q_ b.19.1.2 (Q:) automated matches {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
gecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d2fk0q_:

Click to download the PDB-style file with coordinates for d2fk0q_.
(The format of our PDB-style files is described here.)

Timeline for d2fk0q_: