Lineage for d2fk0l2 (2fk0 L:1-174)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645520Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)
  8. 2645880Domain d2fk0l2: 2fk0 L:1-174 [133639]
    Other proteins in same PDB: d2fk0a1, d2fk0a2, d2fk0b2, d2fk0c2, d2fk0c3, d2fk0d3, d2fk0e2, d2fk0e3, d2fk0f3, d2fk0g2, d2fk0g3, d2fk0h3, d2fk0i2, d2fk0i3, d2fk0j3, d2fk0k2, d2fk0k3, d2fk0l3, d2fk0m2, d2fk0m3, d2fk0n3, d2fk0o2, d2fk0o3, d2fk0p3, d2fk0q2, d2fk0q3, d2fk0r3
    automated match to d2fk0b1

Details for d2fk0l2

PDB Entry: 2fk0 (more details), 2.95 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin.
PDB Compounds: (L:) Hemagglutinin

SCOPe Domain Sequences for d2fk0l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk0l2 h.3.1.1 (L:1-174) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis

SCOPe Domain Coordinates for d2fk0l2:

Click to download the PDB-style file with coordinates for d2fk0l2.
(The format of our PDB-style files is described here.)

Timeline for d2fk0l2:

2645880
d2fk0l2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2fk0l3