Lineage for d2fk0j_ (2fk0 J:)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1467291Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1467292Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1467293Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1467294Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1467295Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries)
  8. 1467419Domain d2fk0j_: 2fk0 J: [133637]
    Other proteins in same PDB: d2fk0a1, d2fk0c_, d2fk0e_, d2fk0g_, d2fk0i_, d2fk0k_, d2fk0m_, d2fk0o_, d2fk0q_
    automated match to d2fk0b1

Details for d2fk0j_

PDB Entry: 2fk0 (more details), 2.95 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin.
PDB Compounds: (J:) Hemagglutinin

SCOPe Domain Sequences for d2fk0j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk0j_ h.3.1.1 (J:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss

SCOPe Domain Coordinates for d2fk0j_:

Click to download the PDB-style file with coordinates for d2fk0j_.
(The format of our PDB-style files is described here.)

Timeline for d2fk0j_: