Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (8 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries) |
Domain d2fk0f_: 2fk0 F: [133633] Other proteins in same PDB: d2fk0a1, d2fk0c_, d2fk0e_, d2fk0g_, d2fk0i_, d2fk0k_, d2fk0m_, d2fk0o_, d2fk0q_ automated match to d2fk0b1 |
PDB Entry: 2fk0 (more details), 2.95 Å
SCOPe Domain Sequences for d2fk0f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fk0f_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss
Timeline for d2fk0f_: