Lineage for d2fk0b1 (2fk0 B:1-175)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 895846Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 895847Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 895848Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 895849Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 895850Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)
  8. 895949Domain d2fk0b1: 2fk0 B:1-175 [133629]
    Other proteins in same PDB: d2fk0a1, d2fk0c1, d2fk0e1, d2fk0g1, d2fk0i1, d2fk0k1, d2fk0m1, d2fk0o1, d2fk0q1
    complexed with bma, nag

Details for d2fk0b1

PDB Entry: 2fk0 (more details), 2.95 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin.
PDB Compounds: (B:) Hemagglutinin

SCOP Domain Sequences for d2fk0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk0b1 h.3.1.1 (B:1-175) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss

SCOP Domain Coordinates for d2fk0b1:

Click to download the PDB-style file with coordinates for d2fk0b1.
(The format of our PDB-style files is described here.)

Timeline for d2fk0b1: