Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein) |
Protein Influenza hemagglutinin (stalk) [58066] (2 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries) |
Domain d2fk0b1: 2fk0 B:1-175 [133629] Other proteins in same PDB: d2fk0a1, d2fk0c1, d2fk0e1, d2fk0g1, d2fk0i1, d2fk0k1, d2fk0m1, d2fk0o1, d2fk0q1 complexed with bma, nag |
PDB Entry: 2fk0 (more details), 2.95 Å
SCOP Domain Sequences for d2fk0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fk0b1 h.3.1.1 (B:1-175) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss
Timeline for d2fk0b1: