SCOPe 2.08: Domain d2fjsb2: 2fjs B:162-340

Lineage for d2fjsb2 (2fjs B:162-340)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries)

8. Domain d2fjsb2: 2fjs B:162-340 [133619]
   automated match to d3h4fa2
   complexed with act, cu, cu1, trs

Details for d2fjsb2

PDB Entry: 2fjs, 1.85 Å

PDB Description: crystal structure of anaerobically reduced wild type nitrite reductase from a. faecalis

PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2fjsb2:

Sequence; same for both SEQRES and ATOM records:

>d2fjsb2 b.6.1.0 (B:162-340) automated matches {Alcaligenes faecalis [TaxId: 511]}
lhdgkgkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfn
gavgaltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetw
fipggaagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt

Timeline for d2fjsb2:

• d2fjsb2 first appeared in SCOP 1.73
  
• d2fjsb2 appears in SCOPe 2.07