SCOPe 2.06: Domain d2fjpb2: 2fjp B:509-766

Lineage for d2fjpb2 (2fjp B:509-766)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller
   automatically mapped to Pfam PF00326

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82499] (55 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d2fjpb2: 2fjp B:509-766 [133615]
   Other proteins in same PDB: d2fjpa1, d2fjpb1
   automated match to d1orva2
   complexed with nag, s14

Details for d2fjpb2

PDB Entry: 2fjp, 2.4 Å

PDB Description: human dipeptidyl peptidase iv/cd26 in complex with an inhibitor

PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2fjpb2:

Sequence; same for both SEQRES and ATOM records:

>d2fjpb2 c.69.1.24 (B:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d2fjpb2:

• d2fjpb2 first appeared in SCOP 1.73
  
• d2fjpb2 appears in SCOPe 2.05
  
• d2fjpb2 appears in SCOPe 2.07
  
• d2fjpb2 appears in the current release, SCOPe 2.08