![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) ![]() |
![]() | Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins) |
![]() | Protein Vascular endothelial growth factor, VEGF [57505] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57506] (15 PDB entries) |
![]() | Domain d2fjgw1: 2fjg W:14-107 [133608] Other proteins in same PDB: d2fjgb1, d2fjgb2, d2fjgh1, d2fjgh2 automatically matched to d1katv_ complexed with so4 |
PDB Entry: 2fjg (more details), 2.8 Å
SCOP Domain Sequences for d2fjgw1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjgw1 g.17.1.1 (W:14-107) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]} vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvptee snitmqimrikphqgqhigemsflqhnkcecrpk
Timeline for d2fjgw1: