Lineage for d2fjgb2 (2fjg B:121-223)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358964Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2358971Species Human (Homo sapiens) [TaxId:9606] [88575] (184 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2359133Domain d2fjgb2: 2fjg B:121-223 [133604]
    Other proteins in same PDB: d2fjga1, d2fjga2, d2fjgb1, d2fjgh1, d2fjgl1, d2fjgl2, d2fjgv_, d2fjgw_
    automatically matched to d1ngzb2
    complexed with so4

Details for d2fjgb2

PDB Entry: 2fjg (more details), 2.8 Å

PDB Description: Structure of the G6 Fab, a phage derived Fab fragment, in complex with VEGF
PDB Compounds: (B:) Fab heavy chain

SCOPe Domain Sequences for d2fjgb2:

Sequence, based on SEQRES records: (download)

>d2fjgb2 b.1.1.2 (B:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records): (download)

>d2fjgb2 b.1.1.2 (B:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d2fjgb2:

Click to download the PDB-style file with coordinates for d2fjgb2.
(The format of our PDB-style files is described here.)

Timeline for d2fjgb2: