SCOP 1.73: Domain d2fjgb1: 2fjg B:1-120

Lineage for d2fjgb1 (2fjg B:1-120)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (66 PDB entries)

8. Domain d2fjgb1: 2fjg B:1-120 [133603]
   Other proteins in same PDB: d2fjgb2, d2fjgh2, d2fjgv1, d2fjgw1
   automatically matched to d1fvcb_
   complexed with so4

Details for d2fjgb1

PDB Entry: 2fjg, 2.8 Å

PDB Description: Structure of the G6 Fab, a phage derived Fab fragment, in complex with VEGF

PDB Compounds: (B:) Fab heavy chain

SCOP Domain Sequences for d2fjgb1:

Sequence; same for both SEQRES and ATOM records:

>d2fjgb1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss

Timeline for d2fjgb1:

• d2fjgb1 is new in SCOP 1.73
  
• d2fjgb1 appears in SCOP 1.75
  
• d2fjgb1 last appears in SCOPe 2.07