Lineage for d2fjfv2 (2fjf V:121-223)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655115Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655260Domain d2fjfv2: 2fjf V:121-223 [133600]
    Other proteins in same PDB: d2fjfb1, d2fjfd1, d2fjff1, d2fjfh1, d2fjfi1, d2fjfk1, d2fjfn1, d2fjfp1, d2fjfr1, d2fjft1, d2fjfv1, d2fjfx1
    automatically matched to d1ngzb2

Details for d2fjfv2

PDB Entry: 2fjf (more details), 2.65 Å

PDB Description: Structure of the G6 Fab, a phage derived VEGF binding Fab
PDB Compounds: (V:) Heavy Chain of a VEGF binding Antibody

SCOP Domain Sequences for d2fjfv2:

Sequence, based on SEQRES records: (download)

>d2fjfv2 b.1.1.2 (V:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records): (download)

>d2fjfv2 b.1.1.2 (V:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d2fjfv2:

Click to download the PDB-style file with coordinates for d2fjfv2.
(The format of our PDB-style files is described here.)

Timeline for d2fjfv2: