Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody |
Domain d2fjfv2: 2fjf V:121-223 [133600] Other proteins in same PDB: d2fjfa1, d2fjfa2, d2fjfb_, d2fjfc1, d2fjfc2, d2fjfd_, d2fjfe1, d2fjfe2, d2fjff_, d2fjfg1, d2fjfg2, d2fjfh_, d2fjfi_, d2fjfj1, d2fjfj2, d2fjfk_, d2fjfl1, d2fjfl2, d2fjfm1, d2fjfm2, d2fjfn_, d2fjfo1, d2fjfo2, d2fjfp_, d2fjfq1, d2fjfq2, d2fjfr1, d2fjfs1, d2fjfs2, d2fjft1, d2fjfu1, d2fjfu2, d2fjfv1, d2fjfw1, d2fjfw2, d2fjfx1 automatically matched to d1ngzb2 |
PDB Entry: 2fjf (more details), 2.65 Å
SCOPe Domain Sequences for d2fjfv2:
Sequence, based on SEQRES records: (download)
>d2fjfv2 b.1.1.2 (V:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
>d2fjfv2 b.1.1.2 (V:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d2fjfv2:
View in 3D Domains from other chains: (mouse over for more information) d2fjfa1, d2fjfa2, d2fjfb_, d2fjfc1, d2fjfc2, d2fjfd_, d2fjfe1, d2fjfe2, d2fjff_, d2fjfg1, d2fjfg2, d2fjfh_, d2fjfi_, d2fjfj1, d2fjfj2, d2fjfk_, d2fjfl1, d2fjfl2, d2fjfm1, d2fjfm2, d2fjfn_, d2fjfo1, d2fjfo2, d2fjfp_, d2fjfq1, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs1, d2fjfs2, d2fjft1, d2fjft2, d2fjfu1, d2fjfu2, d2fjfw1, d2fjfw2, d2fjfx1, d2fjfx2 |