Lineage for d2fjfv2 (2fjf V:121-223)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747669Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2747676Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2747801Domain d2fjfv2: 2fjf V:121-223 [133600]
    Other proteins in same PDB: d2fjfa1, d2fjfa2, d2fjfb_, d2fjfc1, d2fjfc2, d2fjfd_, d2fjfe1, d2fjfe2, d2fjff_, d2fjfg1, d2fjfg2, d2fjfh_, d2fjfi_, d2fjfj1, d2fjfj2, d2fjfk_, d2fjfl1, d2fjfl2, d2fjfm1, d2fjfm2, d2fjfn_, d2fjfo1, d2fjfo2, d2fjfp_, d2fjfq1, d2fjfq2, d2fjfr1, d2fjfs1, d2fjfs2, d2fjft1, d2fjfu1, d2fjfu2, d2fjfv1, d2fjfw1, d2fjfw2, d2fjfx1
    automatically matched to d1ngzb2

Details for d2fjfv2

PDB Entry: 2fjf (more details), 2.65 Å

PDB Description: Structure of the G6 Fab, a phage derived VEGF binding Fab
PDB Compounds: (V:) Heavy Chain of a VEGF binding Antibody

SCOPe Domain Sequences for d2fjfv2:

Sequence, based on SEQRES records: (download)

>d2fjfv2 b.1.1.2 (V:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records): (download)

>d2fjfv2 b.1.1.2 (V:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d2fjfv2:

Click to download the PDB-style file with coordinates for d2fjfv2.
(The format of our PDB-style files is described here.)

Timeline for d2fjfv2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fjfv1