SCOP 1.73: Domain d2fjft2: 2fjf T:121-223

Lineage for d2fjft2 (2fjf T:121-223)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2fjft2: 2fjf T:121-223 [133598]
   Other proteins in same PDB: d2fjfb1, d2fjfd1, d2fjff1, d2fjfh1, d2fjfi1, d2fjfk1, d2fjfn1, d2fjfp1, d2fjfr1, d2fjft1, d2fjfv1, d2fjfx1
   automatically matched to d1ngzb2

Details for d2fjft2

PDB Entry: 2fjf, 2.65 Å

PDB Description: Structure of the G6 Fab, a phage derived VEGF binding Fab

PDB Compounds: (T:) Heavy Chain of a VEGF binding Antibody

SCOP Domain Sequences for d2fjft2:

Sequence, based on SEQRES records:

>d2fjft2 b.1.1.2 (T:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records):

>d2fjft2 b.1.1.2 (T:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d2fjft2:

• d2fjft2 is new in SCOP 1.73
  
• d2fjft2 appears in SCOP 1.75
  
• d2fjft2 appears in the current release, SCOPe 2.08