| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
| Domain d2fjfi2: 2fjf I:121-223 [133588] Other proteins in same PDB: d2fjfb1, d2fjfd1, d2fjff1, d2fjfh1, d2fjfi1, d2fjfk1, d2fjfn1, d2fjfp1, d2fjfr1, d2fjft1, d2fjfv1, d2fjfx1 automatically matched to d1ngzb2 |
PDB Entry: 2fjf (more details), 2.65 Å
SCOP Domain Sequences for d2fjfi2:
Sequence, based on SEQRES records: (download)
>d2fjfi2 b.1.1.2 (I:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
>d2fjfi2 b.1.1.2 (I:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d2fjfi2: