Lineage for d2fjdd_ (2fjd D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1203811Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 1203940Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1203941Protein Adenylylsulfate reductase B subunit [69726] (1 species)
    includes N-terminal partly folded tail
  7. 1203942Species Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries)
  8. 1203950Domain d2fjdd_: 2fjd D: [133576]
    automated match to d1jnrb_
    complexed with sf4, sfd

Details for d2fjdd_

PDB Entry: 2fjd (more details), 1.84 Å

PDB Description: adenosine-5-phosphosulfate reductase in complex with sulfite (covalent adduct)
PDB Compounds: (D:) adenylylsulfate reductase, subunit B

SCOPe Domain Sequences for d2fjdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjdd_ d.58.1.5 (D:) Adenylylsulfate reductase B subunit {Archaeoglobus fulgidus [TaxId: 2234]}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka

SCOPe Domain Coordinates for d2fjdd_:

Click to download the PDB-style file with coordinates for d2fjdd_.
(The format of our PDB-style files is described here.)

Timeline for d2fjdd_: