Lineage for d2fjab1 (2fja B:702-850)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723374Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 723475Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (11 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 723476Protein Adenylylsulfate reductase B subunit [69726] (1 species)
    includes N-terminal partly folded tail
  7. 723477Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries)
  8. 723486Domain d2fjab1: 2fja B:702-850 [133555]
    automatically matched to d1jnrb_
    complexed with adx, fad, sf4

Details for d2fjab1

PDB Entry: 2fja (more details), 2 Å

PDB Description: adenosine 5'-phosphosulfate reductase in complex with substrate
PDB Compounds: (B:) adenylylsulfate reductase, subunit B

SCOP Domain Sequences for d2fjab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjab1 d.58.1.5 (B:702-850) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka

SCOP Domain Coordinates for d2fjab1:

Click to download the PDB-style file with coordinates for d2fjab1.
(The format of our PDB-style files is described here.)

Timeline for d2fjab1:

Domains from other chains:
(mouse over for more information)
d2fjad1