Lineage for d2fjab_ (2fja B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. Protein Adenylylsulfate reductase B subunit [69726] (1 species)
    includes C-terminal partly folded tail
  7. Species Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries)
  8. Domain d2fjab_: 2fja B: [133555]
    automated match to d1jnrb_
    complexed with adx, fad, sf4

Details for d2fjab_

PDB Entry: 2fja (more details), 2 Å

PDB Description: adenosine 5'-phosphosulfate reductase in complex with substrate
PDB Compounds: (B:) adenylylsulfate reductase, subunit B

SCOPe Domain Sequences for d2fjab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjab_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeoglobus fulgidus [TaxId: 2234]}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka

SCOPe Domain Coordinates for d2fjab_ are not available.

Timeline for d2fjab_:

Domains from other chains:
(mouse over for more information)
d2fjad_