![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (23 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.16: Atu0297-like [143275] (1 protein) Pfam PF07045; DUF1330 |
![]() | Protein Hypothetical protein Atu0297 [143276] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [143277] (1 PDB entry) Uniprot Q8UIJ7 1-95 |
![]() | Domain d2fiub1: 2fiu B:1-95 [133538] automatically matched to 2FIU A:1-95 |
PDB Entry: 2fiu (more details), 2 Å
SCOP Domain Sequences for d2fiub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fiub1 d.58.4.16 (B:1-95) Hypothetical protein Atu0297 {Agrobacterium tumefaciens [TaxId: 358]} makgywiaqvdvrdserykdyvstakpaferfganflarggsvtelegtararnvviefp svqhaidcynspeyqaaakirqevadaemmivegi
Timeline for d2fiub1: