Lineage for d2firt1 (2fir T:6-106)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1297328Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1297329Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1297429Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 1297430Species Human (Homo sapiens) [TaxId:9606] [49268] (32 PDB entries)
    Uniprot P13726 33-242
  8. 1297446Domain d2firt1: 2fir T:6-106 [133535]
    Other proteins in same PDB: d2firh_, d2firl1, d2firl2, d2firl3
    automated match to d1uj3c1
    complexed with 0g7, ca, cl, fuc, glc, mg, na, zn

Details for d2firt1

PDB Entry: 2fir (more details), 2 Å

PDB Description: Crystal structure of DFPR-VIIa/sTF
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2firt1:

Sequence, based on SEQRES records: (download)

>d2firt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d2firt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagngeplyenspeftpylet

SCOPe Domain Coordinates for d2firt1:

Click to download the PDB-style file with coordinates for d2firt1.
(The format of our PDB-style files is described here.)

Timeline for d2firt1: