Lineage for d2fika1 (2fik A:186-279)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291386Protein CD1, alpha-3 domain [88615] (5 species)
  7. 1291415Species Mouse (Mus musculus) [TaxId:10090] [88616] (11 PDB entries)
  8. 1291416Domain d2fika1: 2fik A:186-279 [133524]
    Other proteins in same PDB: d2fika2, d2fikb_
    automatically matched to d1cd1a1
    complexed with gsl, nag, plm

Details for d2fika1

PDB Entry: 2fik (more details), 1.8 Å

PDB Description: Structure of a microbial glycosphingolipid bound to mouse CD1d
PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d2fika1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fika1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d2fika1:

Click to download the PDB-style file with coordinates for d2fika1.
(The format of our PDB-style files is described here.)

Timeline for d2fika1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fika2
View in 3D
Domains from other chains:
(mouse over for more information)
d2fikb_