Lineage for d2fiff_ (2fif F:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244274Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1244275Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1244787Family g.39.1.15: A20-like zinc finger [144187] (1 protein)
    Pfam PF01754
  6. 1244788Protein RabGEF1 (Rabex-5), ubiquitin-binding domain [144188] (2 species)
    binds to ubiquitin with the extended C-terminal helix
  7. 1244789Species Cow (Bos taurus) [TaxId:9913] [144189] (2 PDB entries)
    Uniprot O18973 14-73
  8. 1244792Domain d2fiff_: 2fif F: [133523]
    Other proteins in same PDB: d2fifa_, d2fifc_, d2fife_
    automated match to d2fidb1
    complexed with so4, zn

Details for d2fiff_

PDB Entry: 2fif (more details), 2.49 Å

PDB Description: Crystal Structure of a Bovine Rabex-5 fragment complexed with ubiquitin
PDB Compounds: (F:) Rab5 GDP/GTP exchange factor

SCOPe Domain Sequences for d2fiff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fiff_ g.39.1.15 (F:) RabGEF1 (Rabex-5), ubiquitin-binding domain {Cow (Bos taurus) [TaxId: 9913]}
llckkgcgyygnpawqgfcskcwreeyhkarqkqiqedwelaerlqreeeeafass

SCOPe Domain Coordinates for d2fiff_:

Click to download the PDB-style file with coordinates for d2fiff_.
(The format of our PDB-style files is described here.)

Timeline for d2fiff_: