Class g: Small proteins [56992] (94 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.15: A20-like zinc finger [144187] (1 protein) Pfam PF01754 |
Protein RabGEF1 (Rabex-5), ubiquitin-binding domain [144188] (2 species) binds to ubiquitin with the extended C-terminal helix |
Species Cow (Bos taurus) [TaxId:9913] [144189] (2 PDB entries) Uniprot O18973 14-73 |
Domain d2fifb_: 2fif B: [133519] Other proteins in same PDB: d2fifa_, d2fifc_, d2fife_ automated match to d2fidb1 complexed with so4, zn |
PDB Entry: 2fif (more details), 2.49 Å
SCOPe Domain Sequences for d2fifb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fifb_ g.39.1.15 (B:) RabGEF1 (Rabex-5), ubiquitin-binding domain {Cow (Bos taurus) [TaxId: 9913]} sellckkgcgyygnpawqgfcskcwreeyhkarqkqiqedwelaerlqreeeeafassq
Timeline for d2fifb_: