SCOPe 2.06: Domain d2fifb_: 2fif B:

Lineage for d2fifb_ (2fif B:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.15: A20-like zinc finger [144187] (1 protein)
   Pfam PF01754

6. Protein RabGEF1 (Rabex-5), ubiquitin-binding domain [144188] (2 species)
   binds to ubiquitin with the extended C-terminal helix

7. Species Cow (Bos taurus) [TaxId:9913] [144189] (2 PDB entries)
   Uniprot O18973 14-73

8. Domain d2fifb_: 2fif B: [133519]
   Other proteins in same PDB: d2fifa_, d2fifc_, d2fife_
   automated match to d2fidb1
   complexed with so4, zn

Details for d2fifb_

PDB Entry: 2fif, 2.49 Å

PDB Description: Crystal Structure of a Bovine Rabex-5 fragment complexed with ubiquitin

PDB Compounds: (B:) Rab5 GDP/GTP exchange factor

SCOPe Domain Sequences for d2fifb_:

Sequence; same for both SEQRES and ATOM records:

>d2fifb_ g.39.1.15 (B:) RabGEF1 (Rabex-5), ubiquitin-binding domain {Cow (Bos taurus) [TaxId: 9913]}
sellckkgcgyygnpawqgfcskcwreeyhkarqkqiqedwelaerlqreeeeafassq

Timeline for d2fifb_:

• d2fifb_ first appeared in SCOP 1.73, called d2fifb1
  
• d2fifb_ appears in SCOPe 2.05
  
• d2fifb_ appears in SCOPe 2.07
  
• d2fifb_ appears in the current release, SCOPe 2.08