SCOP 1.73: Domain d2fifb1: 2fif B:15-73

Lineage for d2fifb1 (2fif B:15-73)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.15: A20-like zinc finger [144187] (1 protein)
   Pfam PF01754

6. Protein RabGEF1 (Rabex-5), ubiquitin-binding domain [144188] (2 species)
   binds to ubiquitin with the extended C-terminal helix

7. Species Cow (Bos taurus) [TaxId:9913] [144189] (2 PDB entries)

8. Domain d2fifb1: 2fif B:15-73 [133519]
   Other proteins in same PDB: d2fifa1, d2fifc1, d2fife1
   automatically matched to 2FID B:14-73
   complexed with so4, zn

Details for d2fifb1

PDB Entry: 2fif, 2.49 Å

PDB Description: Crystal Structure of a Bovine Rabex-5 fragment complexed with ubiquitin

PDB Compounds: (B:) Rab5 GDP/GTP exchange factor

SCOP Domain Sequences for d2fifb1:

Sequence; same for both SEQRES and ATOM records:

>d2fifb1 g.39.1.15 (B:15-73) RabGEF1 (Rabex-5), ubiquitin-binding domain {Cow (Bos taurus) [TaxId: 9913]}
sellckkgcgyygnpawqgfcskcwreeyhkarqkqiqedwelaerlqreeeeafassq

Timeline for d2fifb1:

• d2fifb1 is new in SCOP 1.73
  
• d2fifb1 appears in SCOP 1.75
  
• d2fifb1 appears in the current release, SCOPe 2.08, called d2fifb_