Lineage for d2fhra2 (2fhr A:0-400)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674916Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 674917Superfamily b.68.1: Sialidases [50939] (2 families) (S)
  5. 674918Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)
  6. 675061Protein Trypanosoma sialidase [82164] (2 species)
  7. 675081Species Trypanosoma rangeli [TaxId:5698] [82165] (10 PDB entries)
  8. 675087Domain d2fhra2: 2fhr A:0-400 [133500]
    Other proteins in same PDB: d2fhra1
    automatically matched to d1n1sa2
    complexed with fsi, gol, so4

Details for d2fhra2

PDB Entry: 2fhr (more details), 2.2 Å

PDB Description: Trypanosoma Rangeli Sialidase In Complex With 2,3- Difluorosialic Acid (Covalent Intermediate)
PDB Compounds: (A:) sialidase

SCOP Domain Sequences for d2fhra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhra2 b.68.1.1 (A:0-400) Trypanosoma sialidase {Trypanosoma rangeli [TaxId: 5698]}
slapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryetsf
dnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktrn
swtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefigg
vgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavleweg
kliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegkr
vmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhei
ntndvyslvfvrligelqlmksvvrtwkeednhlasictpv

SCOP Domain Coordinates for d2fhra2:

Click to download the PDB-style file with coordinates for d2fhra2.
(The format of our PDB-style files is described here.)

Timeline for d2fhra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fhra1