SCOPe 2.06: Domain d2fhra1: 2fhr A:408-631

Lineage for d2fhra1 (2fhr A:408-631)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Trypanosoma rangeli [TaxId:5698] [255027] (3 PDB entries)

8. Domain d2fhra1: 2fhr A:408-631 [133499]
   Other proteins in same PDB: d2fhra2, d2fhra3
   automated match to d1n1ta1
   complexed with fsi, gol, so4

Details for d2fhra1

PDB Entry: 2fhr, 2.2 Å

PDB Description: trypanosoma rangeli sialidase in complex with 2,3- difluorosialic acid (covalent intermediate)

PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d2fhra1:

Sequence; same for both SEQRES and ATOM records:

>d2fhra1 b.29.1.0 (A:408-631) automated matches {Trypanosoma rangeli [TaxId: 5698]}
kggcgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpv
arqgqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrp
lygaapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyi
ggprskgaptdsrvtvtnvvlynrrlnsseirtlflsqdmigtd

Timeline for d2fhra1:

• d2fhra1 first appeared in SCOP 1.73
  
• d2fhra1 appears in SCOPe 2.05
  
• d2fhra1 appears in SCOPe 2.07
  
• d2fhra1 appears in the current release, SCOPe 2.08