Lineage for d2fhra1 (2fhr A:410-631)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664233Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)
  6. 664234Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)
  7. 664254Species Trypanosoma rangeli [TaxId:5698] [82040] (10 PDB entries)
  8. 664260Domain d2fhra1: 2fhr A:410-631 [133499]
    Other proteins in same PDB: d2fhra2
    automatically matched to d1n1sa1
    complexed with fsi, gol, so4

Details for d2fhra1

PDB Entry: 2fhr (more details), 2.2 Å

PDB Description: Trypanosoma Rangeli Sialidase In Complex With 2,3- Difluorosialic Acid (Covalent Intermediate)
PDB Compounds: (A:) sialidase

SCOP Domain Sequences for d2fhra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhra1 b.29.1.15 (A:410-631) Trypanosoma sialidase, C-terminal domain {Trypanosoma rangeli [TaxId: 5698]}
gcgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvar
qgqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrply
gaapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyigg
prskgaptdsrvtvtnvvlynrrlnsseirtlflsqdmigtd

SCOP Domain Coordinates for d2fhra1:

Click to download the PDB-style file with coordinates for d2fhra1.
(The format of our PDB-style files is described here.)

Timeline for d2fhra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fhra2